DATA CHECKED OCT 2026
All states / Michigan

RTK corrections in Michigan

Free  26 options · MDOT CORSContinuously Operating Reference Station. A permanent GPS receiver that records satellite data all day, every day.Full definition · Michigan DOTDepartment of Transportation. The state agency that runs many of the free state RTK networks.Full definition · 2 regional or private networks

Compare all 26 RTK options in Michigan

Every way to get RTKReal-time kinematic. A way to make GPS accurate to about an inch by getting live corrections from a nearby base station.Full definition CorrectionsLive info from a base station about how far off the satellite signals are, so your rover can cancel out the error.Full definition here, side by side: the state network, regional or private networks, and nationwide services. Tap a name for the full details page. Want to know about one exact spot? Check an address or ZIP →

OptionAccessPriceFree trialCasterMount typesNotes
MDOT CORS
State-run network
FreeFree—148.149.0.87:10000—Michigan DOT
MyWay RTK
Ag network
PaidStation owners pay $1,500/yr per station; RoverThe receiver that moves around the job, like a survey pole or a drone. It uses the base's corrections to find its exact spot.Full definition pricing through local partner—After signup—MyWay RTK (Effingham IL) and partner base owners. Ag-focused, brand-agnostic network built from partner-owned bases; coverage is local to each partner
GreenMark Equipment RTK Network
Ag network (dealer)
Paid$1,250/yr first unit, $1,100 second, $900 each additional; 20% off with 3+ subscriptions—Not NTRIPThe standard way RTK corrections are sent over the internet. Think of it as internet radio for correction data.Full definition (built in)—GreenMark Equipment (John Deere dealer). 40+ John Deere Base stationA GNSS receiver sitting still on a known spot. It figures out how wrong the satellite signals are right now and shares that as corrections.Full definition, 10M+ acres around GreenMark's southwest Michigan and northern Indiana stores; 450 MHz radio RTK
Point One Navigation Polaris
Commercial network
PaidVirtual RTK $42/mo per license (~10 cm); True RTK $125/mo per license (1-3 cm); annual discounts14 days, no credit card required; includes Virtual RTK or…polaris.pointonenav.com:2101—US nationwide. Check the provider's coverage map for your area.
GEODNET RTK
Community network
Paid$40/mo or $400/yr per deviceFree RTK trial offered (link on store page)rtk.geodnet.com:2101Nearest single baseGlobal community-built network. Check the provider's coverage map for your area.
RTKdata
Commercial network
Paid$40/mo, $400/yr, or $1,920 for 5 yrs per device30 days, full service, no credit card, no auto-renewrtk.rtkdata.com:2101Nearest single baseGlobal. Check the provider's coverage map for your area.
E38 RTK Premium
Reseller
PaidFrom $100 (shortest term; see page for durations)—rtkpremium.xyz:2101—Reseller; coverage varies by state. Check the provider's coverage map for your area.
Emlid Corrections
Commercial network
Paid1 yr included with eligible Reach receivers; top-up $699/1 yr or $1,199/3 yr per device (via E38)—Not needed (built in)—Emlid receivers only. Check the provider's coverage map for your area.
u-blox PointPerfect Flex
Commercial network
PaidFrom $5.90/mo (up to 100 hrs); 30-day free trial30-day free trial (u-blox and non-u-blox receivers)ppntrip.services.u-blox.com:2101—RTK-SSR, global. Check the provider's coverage map for your area.
Swift Navigation Skylark
Commercial network
PaidFrom $69/mo (1 cm RTK) or $29/mo (sub-decimeter RTK-SSR) per ArduSimple14 daysna.l1l2:2101—Check the provider's coverage map for your area.
Leica (HxGN) SmartNet
Commercial network
PaidNot published—<state:9301iMAX network, nearest single basePrice not published. Check the provider's coverage map for your area.
Trimble VRS Now
Commercial network
PaidNot published—www.vrsnow.us:2101—Price not published. Check the provider's coverage map for your area.
Topcon Topnet Live
Commercial network
Paid$1,800 new US subscription (Topcon store); monthly/project terms via dealers—After signup—US network, 200 stations added Jan 2025; works with any network rover. Check the provider's coverage map for your area.
Carlson SkyNet RTN
Commercial network
Paid$1,500/yr; 14-day free trial14 daysAfter signup—US nationwide, single NTRIP Mount pointOne specific correction stream on a caster, like one channel on a radio. Each one comes from a certain station or network setup.Full definition, 1,700+ bases. Check the provider's coverage map for your area.
RTK2GO
Free community CasterThe internet server that hands out correction streams. Your rover logs in to it, like tuning into a radio station.Full definition
FreeFree community caster; no quality guarantees—rtk2go.com:2101—Coverage depends on volunteer bases. Check the provider's coverage map for your area.
NOAA NGS CORS
Post-processing data
FreeFree post-processing data (RINEXA standard file format for raw GPS data. Any brand of receiver or software can read it.Full definition); not a real-time RTK service—None (data download)—Use for PPKPost-processed kinematic. Like RTK, but the corrections are applied after the job using recorded data, so no live link is needed.Full definition, not live RTK. Check the provider's coverage map for your area.
Onocoy
Nationwide / community
Paid$20 per 30 days + $0.15/hr used—clients.onocoy.com:2101Nearest single baseCommunity-built global network; pay per hour. Check the provider's coverage map for your area.
EarthScope NOTA real-time streams
Nationwide / scientific
FreeFree for non-commercial use; commercial license required—ntrip.earthscope.org:2101Single base (you pick a station)Science-grade stations (NOTA); pick a station near you. Check the provider's coverage map for your area.
Emlid Caster
Free relay for your own base
FreeFree (relay for your own base station)—caster.emlid.com:2101Your own base (single base)Not a network: sends YOUR base's corrections to your rover over the internet. Check the provider's coverage map for your area.
Trimble CenterPoint RTX
Nationwide / satellite PPP
Paid$1,150/yr (US dealer listing)—Not needed (built in)PPP (RTX), delivered by L-band satellite or internetSatellite PPP; works without cell signal; Trimble receivers. Check the provider's coverage map for your area.
Trimble Catalyst
Nationwide / subscription GNSSGlobal Navigation Satellite System. The general name for GPS (USA) and the other satellite systems like GLONASS, Galileo and BeiDou.Full definition
Paid$455/mo per user (dealer listing)—Not needed (built in)—Subscription GNSS for phones/tablets with the DA2 antenna. Check the provider's coverage map for your area.
NovAtel TerraStar
Nationwide / satellite PPP
PaidNot published (dealer quote)—sid-output.com:2101PPP corrections by L-band satellite or internetSatellite PPP (also sold as Leica SmartLink and by Ag Leader). Check the provider's coverage map for your area.
John Deere RTK
Ag network (dealer)
PaidNot published (dealer); forum reports ~$1,250-$1,500/machine/yr—Not NTRIP (built in)—Ag: StarFire receivers via Deere dealers. Check the provider's coverage map for your area.
Case IH AFS RTK+
Ag network (dealer)
Paid$838.10/yr (dealer listing)—After signup—Ag: cellular RTK for Case IH AFS receivers. Check the provider's coverage map for your area.
New Holland PLM RTK+
Ag network (dealer)
PaidNot published (dealer subscription)—After signup—Ag: cellular RTK to a tractor modem, 1.5 cm. Check the provider's coverage map for your area.
IGS real-time streams (IGS-IP / BKG)
Scientific network
FreeFree (registration required)—igs-ip.net:2101Single global stations (raw data) and SSR products for real-time PPPScience streams: raw global stations and real-time PPP orbit/clock corrections; not a plug-and-play RTK service. Check the provider's coverage map for your area.
NOAA CORS (NCN)Free Post-processing onlyFree—No caster (download files)Post-processing (RINEX)92 stations in state. RINEX for PPK and OPUSOnline Positioning User Service. A free NOAA website: upload a GPS file and it emails back the precise position of that spot.Full definition, not live RTK. Stations ↓—

A dash means the operator doesn't publish it. Listings checked Oct 17, 2026.

MDOT CORS

Free
Operator
Michigan DOT
Access
Free
Price
Free
Coverage
Michigan

NTRIP caster

casterProvided by the operator after registration
Operator lists RTK as FREE. NTRIP only, on ports 10000-10006 (host given after login).
Sign up / request access →Network info & station mapFull network details →
VerifiedChecked Oct 16, 2026 · operator source · Sources: [1] [2]

PPK with NOAA CORS in Michigan

NOAANational Oceanic and Atmospheric Administration. The US agency that includes NGS and runs the CORS network.Full definition's permanent base stations record satellite data all day and post it free. You can download those files and use them after a job to correct your drone or rover data (PPK), or to pin down your own base with OPUS. This is not live RTK. This state has 92 working stations. Each NGSNational Geodetic Survey. The part of NOAA that runs the official US coordinate system, CORS and OPUS.Full definition site log has the station's name and details.

LansingMuskegonSault Ste. MarieMuskegonSault Ste. MarieADRIAVCABAYRBIGRBRCHCHSNCLRECPACFRTGGRARHASTHBCHHMLKLANSMETRMIALMIARMIBCMIBHMIBOMIBXMIBYMICAMICCMICPMICVMICWMICXMIDIMIDSMIDTMIFWMIGDMIGHMIGLMIHAMIHDMIHLMIHOMIHTMIHVMIIRMIITMIIWMIKKMIKSMILIMILSMILTMIMAMIMCMIMKMIMNMIMOMIMQMIMRMIMUMINBMINDMINHMINIMINWMIO2MIOGMIOTMIPPMIPVMIPWMIQEMISCMISHMITCMITOMITSMITUMITWMIVAMIWAMIWBMIWCMPLEMSKYNOR1NOR3PTIRSIBYSUP2SUP3UNIVUOFMWARRWRUN
Tap or hover a dot: — NOAA CORS station   City
92 operational NOAA CORS stations plotted at their published positions (NGS ITRF2020 coordinates). State outlines: US Census Bureau via us-atlas. Cities: Natural Earth (public domain).
Station IDLat, LonNGS links
ADRI41.9190, -84.0243Coordinates · Site log
AVCA43.0609, -82.6877Coordinates · Site log
BAYR43.4462, -83.8917Coordinates · Site log
BIGR43.6791, -85.4877Coordinates · Site log
BRCH43.2508, -83.8673Coordinates · Site log
CHSN43.1899, -84.1228Coordinates · Site log
CLRE42.7239, -82.5957Coordinates · Site log
CPAC43.0105, -82.9343Coordinates · Site log
FRTG43.0376, -82.4882Coordinates · Site log
GRAR42.9888, -85.6744Coordinates · Site log
HAST42.6095, -85.2652Coordinates · Site log
HBCH43.8462, -82.6431Coordinates · Site log
HMLK43.4114, -84.2374Coordinates · Site log
LANS42.6739, -84.6633Coordinates · Site log
METR42.6848, -83.2428Coordinates · Site log
MIAL45.0630, -83.4286Coordinates · Site log
MIAR43.9826, -83.9799Coordinates · Site log
MIBC42.3218, -85.2026Coordinates · Site log
MIBH42.0882, -86.3898Coordinates · Site log
MIBO45.2058, -84.9956Coordinates · Site log
MIBX46.7641, -88.5130Coordinates · Site log
MIBY43.6232, -83.9471Coordinates · Site log
MICA43.4280, -82.6680Coordinates · Site log
MICC43.6074, -83.1720Coordinates · Site log
MICP47.4674, -87.8744Coordinates · Site log
MICV41.9227, -85.5162Coordinates · Site log
MICW41.9397, -84.9799Coordinates · Site log
MICX45.3103, -85.2633Coordinates · Site log
MIDI46.0154, -83.7402Coordinates · Site log
MIDS43.0500, -83.5197Coordinates · Site log
MIDT42.4437, -83.0055Coordinates · Site log
MIFW42.2989, -83.0926Coordinates · Site log
MIGD45.0266, -84.6447Coordinates · Site log
MIGH43.0075, -86.2089Coordinates · Site log
MIGL44.6558, -84.7036Coordinates · Site log
MIHA44.0185, -84.8122Coordinates · Site log
MIHD41.8888, -84.6163Coordinates · Site log
MIHL44.3328, -84.7948Coordinates · Site log
MIHO42.8141, -86.0840Coordinates · Site log
MIHT43.6881, -86.3646Coordinates · Site log
MIHV42.8867, -85.8587Coordinates · Site log
MIIR46.0804, -88.6334Coordinates · Site log
MIIT43.2891, -84.5915Coordinates · Site log
MIIW46.4703, -90.1657Coordinates · Site log
MIKK44.7420, -85.1854Coordinates · Site log
MIKS41.8507, -84.3513Coordinates · Site log
MILI42.4350, -83.4150Coordinates · Site log
MILS46.4870, -84.3644Coordinates · Site log
MILT43.9474, -86.4415Coordinates · Site log
MIMA42.5643, -84.4518Coordinates · Site log
MIMC45.7775, -84.7210Coordinates · Site log
MIMK43.2032, -86.2494Coordinates · Site log
MIMN44.3725, -86.1629Coordinates · Site log
MIMO41.9249, -83.4648Coordinates · Site log
MIMQ46.5455, -87.3787Coordinates · Site log
MIMR42.1531, -84.0388Coordinates · Site log
MIMU46.3771, -86.6390Coordinates · Site log
MINB46.2846, -84.2098Coordinates · Site log
MIND45.3848, -84.6299Coordinates · Site log
MINH42.7289, -82.7965Coordinates · Site log
MINI41.8094, -86.2238Coordinates · Site log
MINW45.7901, -87.9183Coordinates · Site log
MIO244.6474, -84.1487Coordinates · Site log
MIOG44.3016, -84.1265Coordinates · Site log
MIOT46.8635, -89.2996Coordinates · Site log
MIPP42.2193, -85.8769Coordinates · Site log
MIPV42.6922, -83.7622Coordinates · Site log
MIPW42.4629, -85.6571Coordinates · Site log
MIQE45.9668, -86.2357Coordinates · Site log
MISC42.9678, -83.8347Coordinates · Site log
MISH42.3842, -86.2646Coordinates · Site log
MITC44.7133, -85.6059Coordinates · Site log
MITO41.8002, -86.6035Coordinates · Site log
MITS43.3013, -85.0872Coordinates · Site log
MITU47.1111, -88.5517Coordinates · Site log
MITW44.2799, -83.5836Coordinates · Site log
MIVA43.3786, -83.5854Coordinates · Site log
MIWA42.7825, -83.0061Coordinates · Site log
MIWB42.6765, -84.2176Coordinates · Site log
MIWC43.5693, -85.7778Coordinates · Site log
MPLE43.6151, -84.7618Coordinates · Site log
MSKY43.2375, -86.0546Coordinates · Site log
NOR144.2558, -85.4372Coordinates · Site log
NOR345.0686, -83.5687Coordinates · Site log
PTIR46.4846, -84.6308Coordinates · Site log
SIBY42.1702, -83.2413Coordinates · Site log
SUP245.7495, -87.0735Coordinates · Site log
SUP346.3027, -85.5128Coordinates · Site log
UNIV42.2856, -84.3859Coordinates · Site log
UOFM42.2958, -83.8397Coordinates · Site log
WARR42.5340, -83.0204Coordinates · Site log
WRUN42.2348, -83.5417Coordinates · Site log
  • Download: daily RINEX files (a standard GPSThe US satellite navigation system. People often use "GPS" to mean all satellite positioning.Full definition file type) at geodesy.noaa.gov/corsdata/rinex/YYYY/DDD/ssss/ or the AWS mirror. Custom time spans are available from UFCORS.
  • How often it records: after 30 days, NGS thins daily files to one reading every 30 seconds. Full-rate data is available from NOAA NCEI CLASS.
  • Set your own base: OPUS. See our OPUS how-to.
PPK how-to →OPUS how-to
Source: NGS CORS data access · station list from NGS ITRFInternational Terrestrial Reference Frame. A worldwide datum. In the US it's about a meter different from NAD 83.Full definition coordinate file (Oct 14, 2026).

Reliability reports

No user reports yet for Michigan networks. We only publish reports from real users. Used it in the field? Tell us how it went.

Something wrong or out of date? Report it.

Get a quote

Dealer quotes in Michigan aren't open yet. For now, use the operator's sign-up or contact link on each listing. Get the monthly email to hear when quotes open.

Quick answers

Is there a free RTK network in Michigan?

Yes. MDOT CORS is listed as free. Check the operator's terms before you sign up.

How many RTK correction options are there in Michigan?

FixFinder lists 26: 1 state-run network, 2 regional or private networks, and 23 nationwide services.

How much does MDOT CORS cost?

Free

What is the NTRIP caster for MDOT CORS?

Host 148.149.0.87, port 10000. You get your username, password and mount point when you register.

Nearby states and related pages

Indiana RTK networksFreeOhio RTK networksFreeWisconsin RTK networksPaidMyWay RTKRegionalGreenMark Equipment RTK NetworkRegionalFree vs paid RTK networksHow-toNTRIP setup guidesHow-to

Price changes and new stations, once a month.

New state networks, price changes and reliability reports. One email a month, no spam.